PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g12900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family CPP
Protein Properties Length: 683aa    MW: 74988.5 Da    PI: 5.3961
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g12900genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.9e-16384422240
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Tp7g12900 384 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 422
                689**********************************96 PP

2TCR52.59.6e-17469507139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  Tp7g12900 469 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 507
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19383424IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.593384509IPR005172CRC domain
PfamPF036386.6E-12386421IPR005172CRC domain
SMARTSM011142.1E-17469510IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.1E-12471507IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MDTPQKSVTQ IGTPISKSRF EDSPVFNYIN SLSPIRPVKS IQNPHQFSSL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHNSS TSDPTNPVEE SRDESTSTEE VAAEAEATKD FNIDASMGNE  120
ASIATELPQI IKYDSCGITH DDPVPASPCG RDTTDLSLVP YAPPQGENGS SEDAATMELQ  180
KMYDNVQGKT ETPDWESLIS DASELLIFGS PNDSEAFRCL MMQRASTSEA RMGMPTMQPD  240
SNNEPESSSA IPYEAVSVLH RGIRRRCLDF EMPGNKQASS ENNTAACESS SRCIVPSIGL  300
HLNAILMSSK DCKTNVTHDY SCSENNQVGL RGSSFTLQET LDQTENETRE DADQNVPVEP  360
TLEELHLNSP KKKRLKLEAG EGESCKRCNC KKSKCLKLYC ECFAAGVYCI EPCSCIDCFN  420
KPIHEDTVLA TRKQIESRNP LAFAPKVIRS SDSVLETGDD ASKTPASARH KRGCNCKKSN  480
CLKKYCECFQ GGVGCSINCR CEGCKNAFGR KDGSSTVDME AEQEEENETS EKNRKAKTQE  540
NTEVFLMRKE ESSALPRTPM SIYRQQPFSS SKNMMPPPQS LLGGGSSSGM FNSQYLRKRE  600
MSSTQSRTEK SFETGAEDGA EEMPEILSHP PIDNIKAVSP NGKRVSPPHL DSSSSGSSLG  660
RRSGGRKLIL QSIPLFPSLT PQR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1369376PKKKRLKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615391e-102AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026871e-102CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973371e-102Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282514.10.0hypothetical protein CARUB_v10007448mg
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGAT4G14770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2